Human-gpDB

	Human-gpDB
	A database of human GPCRs, G-proteins, Effectors and their interactions

home browse blast search advanced search help

Quick search:

Description

Entry page for G-protein - 'Galpha-o_Homo sapiens'

Class	Galpha
Family	Gi/o
Sub-Family	Galpha-o
Type	Galpha-o

Cross References:

References

UniProt	P09471 \| P29777 \| Q8TD72 \| Q9UMV4
EMBL	M60164 \| M60156 \| M60157 \| M60158 \| M60159 \| M60160 \| M60163 \| M60162 \| M60156 \| M60157 \| M60158 \| M60159 \| M60160 \| M60161 \| M19182 \| M19184 \| AF493894 \| AF493895 \| Y18213
InterPro	IPR001019 \| IPR001408
PRODOM	PD000281
GENEID	2775
MIM	139311
PRINTS	PR00318 \| PR00441
PFAM	PF00503

Details:

Details

Name	Galpha-o_Homo sapiens
Description	RecName: Full=Guanine nucleotide-binding protein G(o) subunit alpha
Species	Homo sapiens
Common Name	Human
NCBI Taxonomy	9606
Gene	GNAO
Function	Guanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment	0
Sequence	MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDA AAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY

Effectors:

Effectors

No	Name	Regulation	PubMed
1	Tubulin-Homo sapiens-3	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
2	Tubulin-Homo sapiens-1	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
3	Tubulin-Homo sapiens-10	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
4	Tubulin-Homo sapiens-19	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
5	Voltage dependent R type calcium channel-Homo sapiens	Inhibition	15251227 \| 11031246
6	Adenylate cyclase 1-Homo sapiens	Inhibition	15251227 \| 15922020 \| 14993377 \| 11376933
7	Tubulin-Homo sapiens-26	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
8	Tubulin-Homo sapiens-11	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
9	Tubulin-Homo sapiens-20	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
10	Tubulin-Homo sapiens-22	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
11	Tubulin-Homo sapiens-13	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
12	Tubulin-Homo sapiens-8	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
13	Tubulin-Homo sapiens-21	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
14	Tubulin-Homo sapiens-14	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
15	Tubulin-Homo sapiens-5	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
16	G-protein-regulated inducer of neurite outgrowth GRIN2-Homo sapiens	Unknown	15251227 \| 10480904 \| 14671004
17	Tubulin-Homo sapiens-27	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
18	Tubulin-Homo sapiens-4	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
19	Tubulin-Homo sapiens-17	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
20	Tubulin-Homo sapiens-18	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
21	Tubulin-Homo sapiens-25	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
22	Tubulin-Homo sapiens-16	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
23	Tubulin-Homo sapiens-6	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
24	G-protein-regulated inducer of neurite outgrowth GRIN1-Homo sapiens	Unknown	15251227 \| 10480904 \| 14671004
25	Tubulin-Homo sapiens-9	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
26	Src tyrosine kinase-Homo sapiens-1	Stimulation	11007482 \| 15251227 \| 12209124
27	Adenylate cyclase 6-Homo sapiens	Inhibition	15251227 \| 15922020 \| 14993377 \| 11376933
28	Tubulin-Homo sapiens-23	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
29	Voltage dependent N type calcium channel-Homo sapiens	Inhibition	15251227 \| 11031246
30	Tubulin-Homo sapiens-7	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
31	Tubulin-Homo sapiens-2	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
32	Voltage dependent P/Q type calcium channel-Homo sapiens	Inhibition	15251227 \| 11031246 \| 11395521
33	Src tyrosine kinase-Homo sapiens-2	Stimulation	11007482 \| 15251227 \| 12209124
34	Tubulin-Homo sapiens-12	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
35	Tubulin-Homo sapiens-24	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
36	Tubulin-Homo sapiens-15	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
37	Adenylate cyclase 5-Homo sapiens	Inhibition	15251227 \| 15922020 \| 14993377 \| 11376933

Interacton with GPCRs:

Coupling with GPCRs

Name

Coupling

PubMed