Human-gpDB

	Human-gpDB
	A database of human GPCRs, G-proteins, Effectors and their interactions

home browse blast search advanced search help

Quick search:

Description

Entry page for G-protein - 'Galpha-s_Homo sapiens_2'

Class	Galpha
Family	Gs
Sub-Family	Galpha-s
Type	Galpha-s

Cross References:

References

UniProt	P63092 \| P04895 \| Q12927 \| Q14433 \| Q32P26 \| Q5JWD2 \| Q5JWD4 \| Q5JWD5
EMBL	X04408 \| X04409 \| M21142 \| M21139 \| M21740 \| M21140 \| M21741 \| M21141 \| M21142 \| M21139 \| M21740 \| M21140 \| M21741 \| M21141 \| M21142 \| M21139 \| M21141 \| M21740 \| M21741 \| M21142 \| M21139 \| M21740 \| M21741 \| M21141 \| U12466 \| X07036 \| AF493897 \| AF493898 \| BT009905 \| AL109840 \| AL121917 \| AL109840 \| AL121917 \| AL109840 \| AL121917 \| AL109840 \| AL121917 \| AL121917 \| AL109840 \| AL121917 \| AL109840 \| AL121917 \| AL109840 \| AL121917 \| AL109840 \| CH471077 \| BC002722 \| BC008855 \| BC066923 \| BC022875 \| BC104928 \| BC108315 \| M14631
InterPro	IPR001019 \| IPR000367
PRODOM	PD000281
GENEID	2778
MIM	102200 \| 103580 \| 139320 \| 166350 \| 174800 \| 219080 \| 603233
PRINTS	PR00318 \| PR00443
PFAM	PF00503

Details:

Details

Name	Galpha-s_Homo sapiens_2
Description	RecName: Full=Guanine nucleotide-binding protein G(s) subunit alpha isoforms short;AltName: Full=Adenylate cyclase-stimulating G alpha protein
Species	Homo sapiens
Common Name	Human
NCBI Taxonomy	9606
Gene	GNAS \| GNAS1,GS
Function	Guanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment	0
Sequence	MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQM RILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELA NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLD KIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFND VTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY PHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL

Effectors:

Effectors

No	Name	Regulation	PubMed
1	Tubulin-Homo sapiens-3	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
2	Tubulin-Homo sapiens-1	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
3	Tubulin-Homo sapiens-10	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
4	Adenylate cyclase 7-Homo sapiens	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
5	Tubulin-Homo sapiens-19	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
6	Adenylate cyclase 2-Homo sapiens	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
7	Adenylate cyclase 1-Homo sapiens	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
8	Tubulin-Homo sapiens-26	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
9	Tubulin-Homo sapiens-11	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
10	Tubulin-Homo sapiens-20	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
11	Tubulin-Homo sapiens-22	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
12	Tubulin-Homo sapiens-13	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
13	Tubulin-Homo sapiens-8	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
14	Tubulin-Homo sapiens-21	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
15	Tubulin-Homo sapiens-14	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
16	Tubulin-Homo sapiens-5	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
17	Tubulin-Homo sapiens-27	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
18	Tubulin-Homo sapiens-4	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
19	Tubulin-Homo sapiens-17	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
20	Tubulin-Homo sapiens-18	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
21	Tubulin-Homo sapiens-25	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
22	Tubulin-Homo sapiens-6	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
23	Tubulin-Homo sapiens-16	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
24	Tubulin-Homo sapiens-9	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
25	Src tyrosine kinase-Homo sapiens-1	Stimulation	11007482 \| 15251227 \| 12209124
26	Adenylate cyclase 6-Homo sapiens	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
27	Tubulin-Homo sapiens-23	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
28	Adenylate cyclase 3-Homo sapiens	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
29	Tubulin-Homo sapiens-7	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
30	Adenylate cyclase 9-Homo sapiens	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
31	RGS PX1-Homo sapiens	Stimulation	15251227
32	Tubulin-Homo sapiens-2	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
33	Adenylate cyclase 8-Homo sapiens	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
34	Adenylate cyclase 4-Homo sapiens	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933
35	Src tyrosine kinase-Homo sapiens-2	Stimulation	11007482 \| 15251227 \| 12209124
36	Tubulin-Homo sapiens-12	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
37	Tubulin-Homo sapiens-24	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
38	Tubulin-Homo sapiens-15	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
39	Adenylate cyclase 5-Homo sapiens	Stimulation	15251227 \| 15922020 \| 14993377 \| 11376933

Interacton with GPCRs:

Coupling with GPCRs

Name

Coupling

PubMed