| Description |
Entry page for Effector - 'Phosphodiesterase 6-Homo sapiens-5'
|
|
|
|
Cross References: |
| References |
|
|
Details: |
| Details |
| Name | Phosphodiesterase 6-Homo sapiens-5 |
| Description | "RecName: Full=Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma; Short=GMP-PDE gamma; EC=3.1.4.17;" |
| Species | Homo sapiens |
| Common Name | Human |
| NCBI Taxonomy | 9606 |
| Gene | PDE6 |
| Function | Participates in processes of transmission ands amplification of the visual signal |
| Fragment | 0 |
| Sequence | MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDI TVICPWEAFSHLELHELAQFGII
|
|
|
Interacting with G-proteins: |
| G-proteins |
|
| GPCR, G-protein, Effector interaction |
Visualizaton of GPCR, G-protein, Effector interaction at protein level
|