Human-gpDB

	Human-gpDB
	A database of human GPCRs, G-proteins, Effectors and their interactions

home browse blast search advanced search help

Quick search:

Description

Entry page for G-protein - 'Galpha-i1_Homo sapiens'

Class	Galpha
Family	Gi/o
Sub-Family	Galpha-i
Type	Galpha-i1

Cross References:

References

UniProt	P63096 \| A8KA88 \| P04898 \| P11015 \| P31871 \| Q5U074 \| Q8TAN5 \| Q9UGA4
EMBL	AF493905 \| AF055013 \| AL049933 \| BT019775 \| AK292953 \| CH471091 \| BC026326 \| M20596 \| M20594 \| M20595 \| M17219
InterPro	IPR001019 \| IPR001408
PRODOM	PD000281
GENEID	2770
MIM	139310
PRINTS	PR00318 \| PR00441
PFAM	PF00503

Details:

Details

Name	Galpha-i1_Homo sapiens
Description	"RecName: Full=Guanine nucleotide-binding protein G(i), alpha-1 subunit;AltName: Full=Adenylate cyclase-inhibiting G alpha protein;"
Species	Homo sapiens
Common Name	Human
NCBI Taxonomy	9606
Gene	GNAI
Function	Guanine nucleotide-binding proteins (G proteins) ares involved as modulators or transducers in various transmembranes signaling systems
Fragment	0
Sequence	MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF

Effectors:

Effectors

No	Name	Regulation	PubMed
1	Tubulin-Homo sapiens-3	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
2	Tubulin-Homo sapiens-1	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
3	Tubulin-Homo sapiens-10	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
4	Tubulin-Homo sapiens-19	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
5	Adenylate cyclase 1-Homo sapiens	Inhibition	15251227 \| 15922020 \| 14993377 \| 11376933
6	Tubulin-Homo sapiens-26	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
7	Tubulin-Homo sapiens-11	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
8	Rap1GAPII-Homo sapiens-2	Sequestration of RAP1GAP	10476970 \| 15251227
9	Tubulin-Homo sapiens-20	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
10	Tubulin-Homo sapiens-22	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
11	Tubulin-Homo sapiens-13	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
12	Tubulin-Homo sapiens-8	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
13	Tubulin-Homo sapiens-21	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
14	Tubulin-Homo sapiens-14	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
15	Tubulin-Homo sapiens-5	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
16	G-protein-regulated inducer of neurite outgrowth GRIN2-Homo sapiens	Unknown	15251227 \| 10480904 \| 14671004
17	Tubulin-Homo sapiens-27	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
18	Tubulin-Homo sapiens-4	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
19	Tubulin-Homo sapiens-17	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
20	Tubulin-Homo sapiens-18	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
21	Tubulin-Homo sapiens-25	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
22	Tubulin-Homo sapiens-6	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
23	Tubulin-Homo sapiens-16	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
24	G-protein-regulated inducer of neurite outgrowth GRIN1-Homo sapiens	Unknown	15251227 \| 10480904 \| 14671004
25	Tubulin-Homo sapiens-9	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
26	Src tyrosine kinase-Homo sapiens-1	Stimulation	11007482 \| 15251227 \| 12209124
27	Adenylate cyclase 6-Homo sapiens	Inhibition	15251227 \| 15922020 \| 14993377 \| 11376933
28	Rac-Homo sapiens-1	Stimulation	11099498
29	Tubulin-Homo sapiens-23	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
30	Tubulin-Homo sapiens-7	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
31	Rac-Homo sapiens-2	Stimulation	11099498
32	Tubulin-Homo sapiens-2	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
33	Rac-Homo sapiens-3	Stimulation	11099498
34	Tubulin-Homo sapiens-12	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
35	Src tyrosine kinase-Homo sapiens-2	Stimulation	11007482 \| 15251227 \| 12209124
36	Tubulin-Homo sapiens-24	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
37	Tubulin-Homo sapiens-15	Stimulation of GTPase activity	10224115 \| 15251227 \| 16380086
38	Cdc42-Homo sapiens	Stimulation	11099498
39	Adenylate cyclase 5-Homo sapiens	Inhibition	15251227 \| 15922020 \| 14993377 \| 11376933
40	Rap1GAPII-Homo sapiens-1	Sequestration of RAP1GAP	10476970 \| 15251227

Interacton with GPCRs:

Coupling with GPCRs

Name

Coupling

PubMed